SCOP 1.73: Domain d2j9aa1: 2j9a A:160-484

Lineage for d2j9aa1 (2j9a A:160-484)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (1 protein)

6. Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53203] (9 PDB entries)

8. Domain d2j9aa1: 2j9a A:160-484 [138149]
   Other proteins in same PDB: d2j9aa2
   automatically matched to d1blle2
   complexed with ahy, cl, dms, mpd, zn

Details for d2j9aa1

PDB Entry: 2j9a, 1.73 Å

PDB Description: bllap in complex with microginin fr1

PDB Compounds: (A:) cytosol aminopeptidase

SCOP Domain Sequences for d2j9aa1:

Sequence; same for both SEQRES and ATOM records:

>d2j9aa1 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsq

Timeline for d2j9aa1:

• d2j9aa1 is new in SCOP 1.73
  
• d2j9aa1 appears in SCOP 1.75
  
• d2j9aa1 appears in the current release, SCOPe 2.08