SCOPe 2.08: Domain d2j9aa1: 2j9a A:160-485

Lineage for d2j9aa1 (2j9a A:160-485)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
   automatically mapped to Pfam PF00883

6. Protein automated matches [254524] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255155] (2 PDB entries)

8. Domain d2j9aa1: 2j9a A:160-485 [138149]
   Other proteins in same PDB: d2j9aa2
   automated match to d1lama1
   complexed with ahy, cl, dms, mpd, zn

Details for d2j9aa1

PDB Entry: 2j9a, 1.73 Å

PDB Description: bllap in complex with microginin fr1

PDB Compounds: (A:) cytosol aminopeptidase

SCOPe Domain Sequences for d2j9aa1:

Sequence; same for both SEQRES and ATOM records:

>d2j9aa1 c.56.5.3 (A:160-485) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsqe

Timeline for d2j9aa1:

• d2j9aa1 first appeared in SCOP 1.73
  
• d2j9aa1 appears in SCOPe 2.07