Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) has an additional strand at the C-terminus and a helix inserted after the first strand |
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries) |
Domain d2j8xd_: 2j8x D: [138144] Other proteins in same PDB: d2j8xa1, d2j8xc_ automated match to d1lqmh_ protein/DNA complex; complexed with ure |
PDB Entry: 2j8x (more details), 2.3 Å
SCOPe Domain Sequences for d2j8xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8xd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} lsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdap eykpwalviqdsngenkikml
Timeline for d2j8xd_: