SCOP 1.73: Domain d2j88l2: 2j88 L:109-205

Lineage for d2j88l2 (2j88 L:109-205)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2j88l2: 2j88 L:109-205 [138138]
   Other proteins in same PDB: d2j88a1, d2j88h1, d2j88l1
   automatically matched to d1a0ql2

Details for d2j88l2

PDB Entry: 2j88, 2.6 Å

PDB Description: Hyaluronidase in complex with a monoclonal IgG Fab fragment

PDB Compounds: (L:) fab

SCOP Domain Sequences for d2j88l2:

Sequence, based on SEQRES records:

>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspi

Sequence, based on observed residues (ATOM records):

>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifvvcflnnfypkdinvkwkgvlnswtdqddstysmsstltltkdeytceat
hktstspi

Timeline for d2j88l2:

• d2j88l2 is new in SCOP 1.73
  
• d2j88l2 appears in SCOP 1.75
  
• d2j88l2 appears in the current release, SCOPe 2.08