![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d2j88l2: 2j88 L:109-205 [138138] Other proteins in same PDB: d2j88a1, d2j88h1, d2j88l1 automatically matched to d1a0ql2 |
PDB Entry: 2j88 (more details), 2.6 Å
SCOP Domain Sequences for d2j88l2:
Sequence, based on SEQRES records: (download)
>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspi
>d2j88l2 b.1.1.2 (L:109-205) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifvvcflnnfypkdinvkwkgvlnswtdqddstysmsstltltkdeytceat hktstspi
Timeline for d2j88l2: