Lineage for d2j88a_ (2j88 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083536Family c.1.8.9: Bee venom hyaluronidase [69387] (2 protein domains)
    distorted barrel lacks the second strand
    automatically mapped to Pfam PF01630
  6. 2083542Protein automated matches [190334] (1 species)
    not a true protein
  7. 2083543Species Honeybee (Apis mellifera) [TaxId:7460] [187156] (1 PDB entry)
  8. 2083544Domain d2j88a_: 2j88 A: [138135]
    Other proteins in same PDB: d2j88h1, d2j88l1, d2j88l2
    automated match to d1fcua_

Details for d2j88a_

PDB Entry: 2j88 (more details), 2.6 Å

PDB Description: Hyaluronidase in complex with a monoclonal IgG Fab fragment
PDB Compounds: (A:) hyalurononglucosaminidase

SCOPe Domain Sequences for d2j88a_:

Sequence, based on SEQRES records: (download)

>d2j88a_ c.1.8.9 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial

Sequence, based on observed residues (ATOM records): (download)

>d2j88a_ c.1.8.9 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkvvar
nggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpykklsv
evvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypycynltp
nqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkealriarq
mttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddintkakcl
qfreylnnelgpavkrial

SCOPe Domain Coordinates for d2j88a_:

Click to download the PDB-style file with coordinates for d2j88a_.
(The format of our PDB-style files is described here.)

Timeline for d2j88a_: