SCOP 1.73: Domain d2j85b1: 2j85 B:2-116

Lineage for d2j85b1 (2j85 B:2-116)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.321: STIV B116-like [143601] (1 superfamily)
   subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface

4. Superfamily d.321.1: STIV B116-like [143602] (1 family)

5. Family d.321.1.1: STIV B116-like [143603] (2 proteins)

6. Protein Hypothetical protein B116 [143604] (1 species)

7. Species Sulfolobus turreted icosahedral virus, STIV [TaxId:269145] [143605] (1 PDB entry)

8. Domain d2j85b1: 2j85 B:2-116 [138134]
   automatically matched to 2J85 A:2-116

Details for d2j85b1

PDB Entry: 2j85, 2.39 Å

PDB Description: b116 of sulfolobus turreted icosahedral virus (stiv)

PDB Compounds: (B:) stiv b116

SCOP Domain Sequences for d2j85b1:

Sequence; same for both SEQRES and ATOM records:

>d2j85b1 d.321.1.1 (B:2-116) Hypothetical protein B116 {Sulfolobus turreted icosahedral virus, STIV [TaxId: 269145]}
gkvfltnafsinmlkefpttitidkldeedfclklelrledgtlinaighdstinlvntl
cgtqlqknrvevkmnegdealiimisqrleegkvlsdkeikdmyrqgkisfyevw

Timeline for d2j85b1:

• d2j85b1 is new in SCOP 1.73
  
• d2j85b1 appears in SCOP 1.75
  
• d2j85b1 appears in the current release, SCOPe 2.08, called d2j85b2