SCOPe 2.08: Domain d2j85b2: 2j85 B:2-116

Lineage for d2j85b2 (2j85 B:2-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.321: STIV B116-like [143601] (1 superfamily)
   subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface

4. Superfamily d.321.1: STIV B116-like [143602] (2 families)

5. Family d.321.1.1: STIV B116-like [143603] (3 proteins)
   automatically mapped to Pfam PF08960

6. Protein automated matches [190729] (1 species)
   not a true protein

7. Species Sulfolobus turreted icosahedral virus [TaxId:269145] [187897] (1 PDB entry)

8. Domain d2j85b2: 2j85 B:2-116 [138134]
   Other proteins in same PDB: d2j85a1, d2j85a2, d2j85b3
   automated match to d2j85a1

Details for d2j85b2

PDB Entry: 2j85, 2.39 Å

PDB Description: b116 of sulfolobus turreted icosahedral virus (stiv)

PDB Compounds: (B:) stiv b116

SCOPe Domain Sequences for d2j85b2:

Sequence; same for both SEQRES and ATOM records:

>d2j85b2 d.321.1.1 (B:2-116) automated matches {Sulfolobus turreted icosahedral virus [TaxId: 269145]}
gkvfltnafsinmlkefpttitidkldeedfclklelrledgtlinaighdstinlvntl
cgtqlqknrvevkmnegdealiimisqrleegkvlsdkeikdmyrqgkisfyevw

Timeline for d2j85b2:

• d2j85b2 first appeared in SCOP 1.73, called d2j85b1
  
• d2j85b2 appears in SCOPe 2.07