![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.321: STIV B116-like [143601] (1 superfamily) subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface |
![]() | Superfamily d.321.1: STIV B116-like [143602] (2 families) ![]() |
![]() | Family d.321.1.1: STIV B116-like [143603] (3 proteins) automatically mapped to Pfam PF08960 |
![]() | Protein automated matches [190729] (1 species) not a true protein |
![]() | Species Sulfolobus turreted icosahedral virus [TaxId:269145] [187897] (1 PDB entry) |
![]() | Domain d2j85b2: 2j85 B:2-116 [138134] Other proteins in same PDB: d2j85a1, d2j85a2, d2j85b3 automated match to d2j85a1 |
PDB Entry: 2j85 (more details), 2.39 Å
SCOPe Domain Sequences for d2j85b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j85b2 d.321.1.1 (B:2-116) automated matches {Sulfolobus turreted icosahedral virus [TaxId: 269145]} gkvfltnafsinmlkefpttitidkldeedfclklelrledgtlinaighdstinlvntl cgtqlqknrvevkmnegdealiimisqrleegkvlsdkeikdmyrqgkisfyevw
Timeline for d2j85b2: