Lineage for d2j7zb_ (2j7z B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries)
  8. Domain d2j7zb_: 2j7z B: [138132]
    automated match to d1sdf__

Details for d2j7zb_

PDB Entry: 2j7z (more details), 1.95 Å

PDB Description: crystal structure of recombinant human stromal cell-derived factor-1alpha
PDB Compounds: (B:) stromal cell-derived factor 1 alpha

SCOPe Domain Sequences for d2j7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7zb_ d.9.1.1 (B:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekalnk

SCOPe Domain Coordinates for d2j7zb_ are not available.

Timeline for d2j7zb_:

Domains from other chains:
(mouse over for more information)
d2j7za_