![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries) |
![]() | Domain d2j7pb2: 2j7p B:89-294 [138122] Other proteins in same PDB: d2j7pa1, d2j7pb1, d2j7pd1, d2j7pd2, d2j7pe1, d2j7pe2 automated match to d1ng1a2 protein/RNA complex; complexed with edo, gnp, iod, k, mg |
PDB Entry: 2j7p (more details), 1.97 Å
SCOPe Domain Sequences for d2j7pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7pb2 c.37.1.10 (B:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy fagvsekpeglepfyperlagrilgm
Timeline for d2j7pb2: