![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal sequence recognition protein Ffh [47366] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries) |
![]() | Domain d2j7pb1: 2j7p B:4-88 [138121] Other proteins in same PDB: d2j7pa2, d2j7pb2, d2j7pd1, d2j7pd2, d2j7pe1, d2j7pe2 automated match to d1ng1a1 protein/RNA complex; complexed with edo, gnp, iod, k, mg |
PDB Entry: 2j7p (more details), 1.97 Å
SCOPe Domain Sequences for d2j7pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7pb1 a.24.13.1 (B:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq vlesltpaevilatvyealkealgg
Timeline for d2j7pb1: