Lineage for d2j7pa2 (2j7p A:89-294)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696707Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 696718Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)
  8. 696732Domain d2j7pa2: 2j7p A:89-294 [138120]
    Other proteins in same PDB: d2j7pa1, d2j7pb1, d2j7pd1, d2j7pd2, d2j7pe1, d2j7pe2
    automatically matched to d2ffha3
    complexed with edo, gnp, iod, k, mg

Details for d2j7pa2

PDB Entry: 2j7p (more details), 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
PDB Compounds: (A:) signal recognition particle protein

SCOP Domain Sequences for d2j7pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7pa2 c.37.1.10 (A:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

SCOP Domain Coordinates for d2j7pa2:

Click to download the PDB-style file with coordinates for d2j7pa2.
(The format of our PDB-style files is described here.)

Timeline for d2j7pa2: