Lineage for d2j7la2 (2j7l A:125-215)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) 
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) Protein PapD [49586] (1 species) Species Escherichia coli [TaxId:562] [49587] (15 PDB entries) 
Domain d2j7la2: 2j7l A:125-215 [138118]
Other proteins in same PDB: d2j7la1
automated match to d3dpaa2
complexed with xc2
Details for d2j7la2
PDB Entry: 2j7l (more details), 2.6 Å
PDB Description: e.coli p pilus chaperone papd in complex with a pilus biogenesis inhibitor, pilicide 2c
PDB Compounds: (A:) chaperone protein papdSCOPe Domain Sequences for d2j7la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7la2 b.7.2.1 (A:125-215) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk
SCOPe Domain Coordinates for d2j7la2:
Click to download the PDB-style file with coordinates for d2j7la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j7la2:
- d2j7la2 first appeared in SCOP 1.73
- d2j7la2 appears in SCOPe 2.07
View in 3D
