SCOPe 2.06: Domain d2j7hb_: 2j7h B:

Lineage for d2j7hb_ (2j7h B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein automated matches [190245] (11 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)

8. Domain d2j7hb_: 2j7h B: [138116]
   automated match to d1od0b_
   complexed with act, azf, ca

Details for d2j7hb_

PDB Entry: 2j7h, 1.95 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with azafagomine

PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d2j7hb_:

Sequence; same for both SEQRES and ATOM records:

>d2j7hb_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngl

Timeline for d2j7hb_:

• d2j7hb_ first appeared in SCOP 1.73, called d2j7hb1
  
• d2j7hb_ appears in SCOPe 2.05
  
• d2j7hb_ appears in SCOPe 2.07
  
• d2j7hb_ appears in the current release, SCOPe 2.08