Lineage for d2j7hb_ (2j7h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083101Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)
  8. 2083127Domain d2j7hb_: 2j7h B: [138116]
    automated match to d1od0b_
    complexed with act, azf, ca

Details for d2j7hb_

PDB Entry: 2j7h (more details), 1.95 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with azafagomine
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d2j7hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7hb_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngl

SCOPe Domain Coordinates for d2j7hb_:

Click to download the PDB-style file with coordinates for d2j7hb_.
(The format of our PDB-style files is described here.)

Timeline for d2j7hb_: