Lineage for d2j78b2 (2j78 B:2-444)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083101Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)
  8. 2083103Domain d2j78b2: 2j78 B:2-444 [138100]
    Other proteins in same PDB: d2j78b3
    automated match to d1od0b_
    complexed with act, ca, edo, gox

Details for d2j78b2

PDB Entry: 2j78 (more details), 1.65 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with gluco-hydroximolactam
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d2j78b2:

Sequence, based on SEQRES records: (download)

>d2j78b2 c.1.8.4 (B:2-444) automated matches {Thermotoga maritima [TaxId: 2336]}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs
edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy
stqkrivkdsgywysnvvknngl

Sequence, based on observed residues (ATOM records): (download)

>d2j78b2 c.1.8.4 (B:2-444) automated matches {Thermotoga maritima [TaxId: 2336]}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
fdpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngl

SCOPe Domain Coordinates for d2j78b2:

Click to download the PDB-style file with coordinates for d2j78b2.
(The format of our PDB-style files is described here.)

Timeline for d2j78b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j78b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2j78a_