SCOP 1.73: Domain d2j6ua2: 2j6u A:5-243

Lineage for d2j6ua2 (2j6u A:5-243)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)

8. Domain d2j6ua2: 2j6u A:5-243 [138094]
   Other proteins in same PDB: d2j6ua1
   automatically matched to d1jx4a2
   complexed with 6og, ca, dgt

Details for d2j6ua2

PDB Entry: 2j6u, 2.5 Å

PDB Description: ternary complex of sulfolobus solfataricus dpo4 dna polymerase, o6-methylguanine modified dna, and dgtp.

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2j6ua2:

Sequence; same for both SEQRES and ATOM records:

>d2j6ua2 e.8.1.7 (A:5-243) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2j6ua2:

• d2j6ua2 is new in SCOP 1.73
  
• d2j6ua2 appears in SCOP 1.75
  
• d2j6ua2 appears in the current release, SCOPe 2.08