SCOPe 2.06: Domain d2j6sa2: 2j6s A:1-240

Lineage for d2j6sa2 (2j6s A:1-240)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein automated matches [231300] (4 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231301] (28 PDB entries)

8. Domain d2j6sa2: 2j6s A:1-240 [138090]
   Other proteins in same PDB: d2j6sa1
   automated match to d2v4ra1
   protein/DNA complex; complexed with ca, dtp

Details for d2j6sa2

PDB Entry: 2j6s, 2.5 Å

PDB Description: ternary complex of sulfolobus solfataricus dpo4 dna polymerase, o6- methylguanine modified dna, and datp.

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2j6sa2:

Sequence; same for both SEQRES and ATOM records:

>d2j6sa2 e.8.1.7 (A:1-240) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2j6sa2:

• d2j6sa2 first appeared in SCOP 1.73
  
• d2j6sa2 appears in SCOPe 2.05
  
• d2j6sa2 appears in SCOPe 2.07
  
• d2j6sa2 appears in the current release, SCOPe 2.08