Lineage for d2j6hb2 (2j6h B:1-240)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222616Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 1222662Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 1222663Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)
    Uniprot P17169 1-238
  8. 1222672Domain d2j6hb2: 2j6h B:1-240 [138087]
    Other proteins in same PDB: d2j6ha1, d2j6hb1
    automatically matched to d1jxaa2
    complexed with g6q, onl

Details for d2j6hb2

PDB Entry: 2j6h (more details), 2.35 Å

PDB Description: e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo-l-norleucine
PDB Compounds: (B:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2j6hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6hb2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d2j6hb2:

Click to download the PDB-style file with coordinates for d2j6hb2.
(The format of our PDB-style files is described here.)

Timeline for d2j6hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j6hb1