Lineage for d2j6eb1 (2j6e B:238-339)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655832Domain d2j6eb1: 2j6e B:238-339 [138082]
    Other proteins in same PDB: d2j6ea2, d2j6eb2
    automatically matched to d1hzhh3
    complexed with act, bma, cac, cd, ful, gal, man, mpd, nag, ndg, zn

Details for d2j6eb1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOP Domain Sequences for d2j6eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6eb1 b.1.1.2 (B:238-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOP Domain Coordinates for d2j6eb1:

Click to download the PDB-style file with coordinates for d2j6eb1.
(The format of our PDB-style files is described here.)

Timeline for d2j6eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j6eb2