![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
![]() | Domain d2j6ea2: 2j6e A:340-445 [138081] Other proteins in same PDB: d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1 automated match to d1hzhh4 complexed with act, cac, cd, mpd, zn |
PDB Entry: 2j6e (more details), 3 Å
SCOPe Domain Sequences for d2j6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6ea2 b.1.1.2 (A:340-445) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
Timeline for d2j6ea2: