Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
Domain d2j6ea2: 2j6e A:340-445 [138081] Other proteins in same PDB: d2j6ea1, d2j6eb1 automatically matched to d1hzhh4 complexed with act, bma, cac, cd, ful, gal, man, mpd, nag, ndg, zn |
PDB Entry: 2j6e (more details), 3 Å
SCOP Domain Sequences for d2j6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6ea2 b.1.1.2 (A:340-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
Timeline for d2j6ea2: