Lineage for d2j6ea1 (2j6e A:236-339)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934151Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 934152Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 934183Domain d2j6ea1: 2j6e A:236-339 [138080]
    Other proteins in same PDB: d2j6ea2, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1, d2j6em2
    automatically matched to d1hzhh3
    complexed with act, cac, cd, mpd, zn

Details for d2j6ea1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2j6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ea1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d2j6ea1:

Click to download the PDB-style file with coordinates for d2j6ea1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ea1: