SCOP 1.73: Domain d2j6ea1: 2j6e A:236-339

Lineage for d2j6ea1 (2j6e A:236-339)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d2j6ea1: 2j6e A:236-339 [138080]
   Other proteins in same PDB: d2j6ea2, d2j6eb2
   automatically matched to d1hzhh3
   complexed with act, bma, cac, cd, ful, gal, man, mpd, nag, ndg, zn

Details for d2j6ea1

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOP Domain Sequences for d2j6ea1:

Sequence; same for both SEQRES and ATOM records:

>d2j6ea1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d2j6ea1:

• d2j6ea1 is new in SCOP 1.73
  
• d2j6ea1 appears in SCOP 1.75
  
• d2j6ea1 appears in the current release, SCOPe 2.08