| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
| Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
| Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [89829] (10 PDB entries) |
| Domain d2j65b2: 2j65 B:128-268 [138077] automatically matched to d1xxea2 complexed with cl, myr, udp, zn; mutant |
PDB Entry: 2j65 (more details), 2.2 Å
SCOP Domain Sequences for d2j65b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j65b2 d.14.1.7 (B:128-268) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk
Timeline for d2j65b2: