Lineage for d2j65b2 (2j65 B:128-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930643Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 2930704Protein automated matches [226920] (2 species)
    not a true protein
  7. 2930705Species Aquifex aeolicus [TaxId:224324] [225178] (1 PDB entry)
  8. 2930709Domain d2j65b2: 2j65 B:128-268 [138077]
    automated match to d1xxea2
    complexed with cl, myr, udp, zn

Details for d2j65b2

PDB Entry: 2j65 (more details), 2.2 Å

PDB Description: structure of lpxc from aquifex aeolicus in complex with udp
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2j65b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j65b2 d.14.1.7 (B:128-268) automated matches {Aquifex aeolicus [TaxId: 224324]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOPe Domain Coordinates for d2j65b2:

Click to download the PDB-style file with coordinates for d2j65b2.
(The format of our PDB-style files is described here.)

Timeline for d2j65b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j65b1