![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
![]() | Protein automated matches [226920] (2 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [225178] (1 PDB entry) |
![]() | Domain d2j65a2: 2j65 A:128-268 [138075] automated match to d1xxea2 complexed with cl, myr, udp, zn |
PDB Entry: 2j65 (more details), 2.2 Å
SCOPe Domain Sequences for d2j65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j65a2 d.14.1.7 (A:128-268) automated matches {Aquifex aeolicus [TaxId: 224324]} epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy sfrgghslnvklvkelakkqk
Timeline for d2j65a2: