SCOPe 2.03: Domain d2j65a1: 2j65 A:2-127

Lineage for d2j65a1 (2j65 A:2-127)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein automated matches [226920] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [225178] (1 PDB entry)

8. Domain d2j65a1: 2j65 A:2-127 [138074]
   automated match to d2go3a1
   complexed with cl, myr, udp, zn

Details for d2j65a1

PDB Entry: 2j65, 2.2 Å

PDB Description: structure of lpxc from aquifex aeolicus in complex with udp

PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2j65a1:

Sequence; same for both SEQRES and ATOM records:

>d2j65a1 d.14.1.7 (A:2-127) automated matches {Aquifex aeolicus [TaxId: 224324]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
dyfvve

Timeline for d2j65a1:

• d2j65a1 first appeared in SCOP 1.73
  
• d2j65a1 appears in SCOPe 2.02
  
• d2j65a1 appears in SCOPe 2.04
  
• d2j65a1 appears in the current release, SCOPe 2.08