Lineage for d2j5xa_ (2j5x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866714Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 2866719Domain d2j5xa_: 2j5x A: [138072]
    automated match to d1e0sa_
    complexed with gsp, mg

Details for d2j5xa_

PDB Entry: 2j5x (more details), 2.8 Å

PDB Description: structure of the small g protein arf6 in complex with gtpgammas
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2j5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5xa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

SCOPe Domain Coordinates for d2j5xa_:

Click to download the PDB-style file with coordinates for d2j5xa_.
(The format of our PDB-style files is described here.)

Timeline for d2j5xa_: