Lineage for d2j5wa5 (2j5w A:892-1040)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303298Protein Ceruloplasmin [49559] (1 species)
    consists of 6 domains of this fold
  7. 1303299Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries)
  8. 1303304Domain d2j5wa5: 2j5w A:892-1040 [138071]
    automatically matched to d1kcw_6
    complexed with ca, cu, gol, na, nag, o, oxy

Details for d2j5wa5

PDB Entry: 2j5w (more details), 2.8 Å

PDB Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d2j5wa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
rrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlq
gltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfp
rtpgiwllhchvtdhihagmettytvlqn

SCOPe Domain Coordinates for d2j5wa5:

Click to download the PDB-style file with coordinates for d2j5wa5.
(The format of our PDB-style files is described here.)

Timeline for d2j5wa5: