![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Ceruloplasmin [49559] (1 species) consists of 6 domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries) |
![]() | Domain d2j5wa5: 2j5w A:892-1040 [138071] automatically matched to d1kcw_6 complexed with ca, cu, gol, na, nag, o, oxy |
PDB Entry: 2j5w (more details), 2.8 Å
SCOP Domain Sequences for d2j5wa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} rrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlq gltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfp rtpgiwllhchvtdhihagmettytvlqn
Timeline for d2j5wa5:
![]() Domains from same chain: (mouse over for more information) d2j5wa1, d2j5wa2, d2j5wa3, d2j5wa4 |