Lineage for d2j5wa4 (2j5w A:706-884)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791573Protein Ceruloplasmin [49559] (1 species)
    consists of 6 domains of this fold
  7. 791574Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries)
  8. 791578Domain d2j5wa4: 2j5w A:706-884 [138070]
    automatically matched to d1kcw_5
    complexed with ca, cu, gol, na, nag, o, oxy

Details for d2j5wa4

PDB Entry: 2j5w (more details), 2.8 Å

PDB Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites
PDB Compounds: (A:) ceruloplasmin

SCOP Domain Sequences for d2j5wa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
stfylgertyyiaavevewdyspqrewekelhhlqeqnvsnafldkgefyigskykkvvy
rqytdstfrvpverkaeeehlgilgpqlhadvgdkvkiifknmatrpysihahgvqtess
tvtptlpgetltyvwkipersgagtedsacipwayystvdqvkdlysgligplivcrrp

SCOP Domain Coordinates for d2j5wa4:

Click to download the PDB-style file with coordinates for d2j5wa4.
(The format of our PDB-style files is described here.)

Timeline for d2j5wa4: