SCOPe 2.03: Domain d2j5wa1: 2j5w A:1-192

Lineage for d2j5wa1 (2j5w A:1-192)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Ceruloplasmin [49559] (1 species)
   consists of 6 domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries)

8. Domain d2j5wa1: 2j5w A:1-192 [138067]
   automatically matched to d1kcw_1
   complexed with ca, cu, gol, na, nag, o, oxy

Details for d2j5wa1

PDB Entry: 2j5w, 2.8 Å

PDB Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d2j5wa1:

Sequence; same for both SEQRES and ATOM records:

>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
ckkdsldkekek

Timeline for d2j5wa1:

• d2j5wa1 first appeared in SCOP 1.73
  
• d2j5wa1 appears in SCOPe 2.02
  
• d2j5wa1 appears in SCOPe 2.04
  
• d2j5wa1 appears in the current release, SCOPe 2.08