![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein automated matches [226882] (10 species) not a true protein |
![]() | Species Haloarcula marismortui [TaxId:2238] [225148] (4 PDB entries) |
![]() | Domain d2j5rc2: 2j5r C:163-330 [138064] Other proteins in same PDB: d2j5ra1, d2j5rb1, d2j5rc1, d2j5rd1 automated match to d1d3aa2 complexed with cl |
PDB Entry: 2j5r (more details), 2.25 Å
SCOPe Domain Sequences for d2j5rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5rc2 d.162.1.1 (C:163-330) automated matches {Haloarcula marismortui [TaxId: 2238]} fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
Timeline for d2j5rc2: