SCOPe 2.08: Domain d2j5rc1: 2j5r C:22-162

Lineage for d2j5rc1 (2j5r C:22-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries)

8. Domain d2j5rc1: 2j5r C:22-162 [138063]
   Other proteins in same PDB: d2j5ra2, d2j5rb2, d2j5rc2, d2j5rd2
   automated match to d1o6za1
   complexed with cl

Details for d2j5rc1

PDB Entry: 2j5r, 2.25 Å

PDB Description: 2.25 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after second radiation burn (radiation damage series)

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2j5rc1:

Sequence; same for both SEQRES and ATOM records:

>d2j5rc1 c.2.1.5 (C:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Timeline for d2j5rc1:

• d2j5rc1 first appeared in SCOP 1.73
  
• d2j5rc1 appears in SCOPe 2.07