Lineage for d2j5rb1 (2j5r B:22-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 688039Protein Malate dehydrogenase [51849] (12 species)
  7. 688047Species Archaeon Haloarcula marismortui [TaxId:2238] [51855] (8 PDB entries)
  8. 688057Domain d2j5rb1: 2j5r B:22-163 [138061]
    Other proteins in same PDB: d2j5ra2, d2j5rb2, d2j5rc2, d2j5rd2
    automatically matched to d1hlpa1
    complexed with cl

Details for d2j5rb1

PDB Entry: 2j5r (more details), 2.25 Å

PDB Description: 2.25 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after second radiation burn (radiation damage series)
PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d2j5rb1:

Sequence, based on SEQRES records: (download)

>d2j5rb1 c.2.1.5 (B:22-163) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvigf

Sequence, based on observed residues (ATOM records): (download)

>d2j5rb1 c.2.1.5 (B:22-163) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
nrhlyeagdrsreqvigf

SCOP Domain Coordinates for d2j5rb1:

Click to download the PDB-style file with coordinates for d2j5rb1.
(The format of our PDB-style files is described here.)

Timeline for d2j5rb1: