Lineage for d2j5qd1 (2j5q D:22-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2453226Protein automated matches [226881] (8 species)
    not a true protein
  7. 2453227Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries)
  8. 2453239Domain d2j5qd1: 2j5q D:22-162 [138057]
    Other proteins in same PDB: d2j5qa2, d2j5qb2, d2j5qc2, d2j5qd2
    automated match to d1o6za1
    complexed with cl

Details for d2j5qd1

PDB Entry: 2j5q (more details), 2.15 Å

PDB Description: 2.15 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after first radiation burn (radiation damage series)
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d2j5qd1:

Sequence, based on SEQRES records: (download)

>d2j5qd1 c.2.1.5 (D:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Sequence, based on observed residues (ATOM records): (download)

>d2j5qd1 c.2.1.5 (D:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
nrhlyeagdrsreqvig

SCOPe Domain Coordinates for d2j5qd1:

Click to download the PDB-style file with coordinates for d2j5qd1.
(The format of our PDB-style files is described here.)

Timeline for d2j5qd1: