SCOP 1.73: Domain d2j5qc1: 2j5q C:22-163

Lineage for d2j5qc1 (2j5q C:22-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [51855] (8 PDB entries)

8. Domain d2j5qc1: 2j5q C:22-163 [138055]
   Other proteins in same PDB: d2j5qa2, d2j5qb2, d2j5qc2, d2j5qd2
   automatically matched to d1hlpa1
   complexed with cl

Details for d2j5qc1

PDB Entry: 2j5q, 2.15 Å

PDB Description: 2.15 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui after first radiation burn (radiation damage series)

PDB Compounds: (C:) malate dehydrogenase

SCOP Domain Sequences for d2j5qc1:

Sequence; same for both SEQRES and ATOM records:

>d2j5qc1 c.2.1.5 (C:22-163) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvigf

Timeline for d2j5qc1:

• d2j5qc1 is new in SCOP 1.73
  
• d2j5qc1 appears in SCOP 1.75
  
• d2j5qc1 appears in the current release, SCOPe 2.08