Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (10 species) not a true protein |
Species Haloarcula marismortui [TaxId:2238] [225148] (4 PDB entries) |
Domain d2j5qb2: 2j5q B:163-330 [138054] Other proteins in same PDB: d2j5qa1, d2j5qb1, d2j5qc1, d2j5qd1 automated match to d1d3aa2 complexed with cl |
PDB Entry: 2j5q (more details), 2.15 Å
SCOPe Domain Sequences for d2j5qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5qb2 d.162.1.1 (B:163-330) automated matches {Haloarcula marismortui [TaxId: 2238]} fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
Timeline for d2j5qb2: