![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein automated matches [226881] (8 species) not a true protein |
![]() | Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries) |
![]() | Domain d2j5qa1: 2j5q A:22-162 [138051] Other proteins in same PDB: d2j5qa2, d2j5qb2, d2j5qc2, d2j5qd2 automated match to d1o6za1 complexed with cl |
PDB Entry: 2j5q (more details), 2.15 Å
SCOPe Domain Sequences for d2j5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5qa1 c.2.1.5 (A:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]} tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn pvdllnrhlyeagdrsreqvig
Timeline for d2j5qa1: