Lineage for d2j5pa1 (2j5p A:1261-1329)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694366Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
    automatically mapped to Pfam PF09397
  6. 2694367Protein DNA translocase FtsK [140296] (2 species)
  7. 2694368Species Escherichia coli [TaxId:562] [140297] (1 PDB entry)
    Uniprot P46889 1261-1329
  8. 2694369Domain d2j5pa1: 2j5p A:1261-1329 [138050]
    Other proteins in same PDB: d2j5pa2

Details for d2j5pa1

PDB Entry: 2j5p (more details)

PDB Description: e. coli ftsk gamma domain
PDB Compounds: (A:) DNA translocase ftsk

SCOPe Domain Sequences for d2j5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5pa1 a.4.5.67 (A:1261-1329) DNA translocase FtsK {Escherichia coli [TaxId: 562]}
gaeeldplfdqavqfvtekrkasisgvqrqfrigynraariieqmeaqgivseqghngnr
evlapppfd

SCOPe Domain Coordinates for d2j5pa1:

Click to download the PDB-style file with coordinates for d2j5pa1.
(The format of our PDB-style files is described here.)

Timeline for d2j5pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j5pa2