Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins) PfamB PB000224 automatically mapped to Pfam PF09397 |
Protein DNA translocase FtsK [140296] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140298] (1 PDB entry) Uniprot Q9I0M3 742-811 |
Domain d2j5oa1: 2j5o A:742-811 [138049] |
PDB Entry: 2j5o (more details)
SCOPe Domain Sequences for d2j5oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5oa1 a.4.5.67 (A:742-811) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]} egseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsr eviapapvrd
Timeline for d2j5oa1: