Lineage for d2j5oa1 (2j5o A:742-811)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694366Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
    automatically mapped to Pfam PF09397
  6. 2694367Protein DNA translocase FtsK [140296] (2 species)
  7. 2694370Species Pseudomonas aeruginosa [TaxId:287] [140298] (1 PDB entry)
    Uniprot Q9I0M3 742-811
  8. 2694371Domain d2j5oa1: 2j5o A:742-811 [138049]

Details for d2j5oa1

PDB Entry: 2j5o (more details)

PDB Description: pseudomonas aeruginosa ftsk gamma domain
PDB Compounds: (A:) DNA translocase ftsk

SCOPe Domain Sequences for d2j5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5oa1 a.4.5.67 (A:742-811) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]}
egseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsr
eviapapvrd

SCOPe Domain Coordinates for d2j5oa1:

Click to download the PDB-style file with coordinates for d2j5oa1.
(The format of our PDB-style files is described here.)

Timeline for d2j5oa1: