Lineage for d2j5lb1 (2j5l B:3-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289118Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (52 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1289165Domain d2j5lb1: 2j5l B:3-107 [138045]
    Other proteins in same PDB: d2j5la1, d2j5lb2, d2j5lc1, d2j5lc2
    automatically matched to d1dqdl1

Details for d2j5lb1

PDB Entry: 2j5l (more details), 2.9 Å

PDB Description: structure of a plasmodium falciparum apical membrane antigen 1-fab f8. 12.19 complex
PDB Compounds: (B:) fab fragment of monoclonal antibody f8.12.19

SCOPe Domain Sequences for d2j5lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5lb1 b.1.1.1 (B:3-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvparfs
gsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleik

SCOPe Domain Coordinates for d2j5lb1:

Click to download the PDB-style file with coordinates for d2j5lb1.
(The format of our PDB-style files is described here.)

Timeline for d2j5lb1: