![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d2j5lb1: 2j5l B:1-107 [138045] Other proteins in same PDB: d2j5la1, d2j5lb2, d2j5lc1, d2j5lc2 automated match to d2g2ra1 |
PDB Entry: 2j5l (more details), 2.9 Å
SCOPe Domain Sequences for d2j5lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5lb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} esvlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvpar fsgsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleik
Timeline for d2j5lb1: