SCOPe 2.08: Domain d2j5kb2: 2j5k B:163-330

Lineage for d2j5kb2 (2j5k B:163-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:2238] [225148] (4 PDB entries)

8. Domain d2j5kb2: 2j5k B:163-330 [138040]
   Other proteins in same PDB: d2j5ka1, d2j5kb1, d2j5kc1, d2j5kd1
   automated match to d1d3aa2
   complexed with cl

Details for d2j5kb2

PDB Entry: 2j5k, 2 Å

PDB Description: 2.0 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui (radiation damage series)

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2j5kb2:

Sequence; same for both SEQRES and ATOM records:

>d2j5kb2 d.162.1.1 (B:163-330) automated matches {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d2j5kb2:

• d2j5kb2 first appeared in SCOP 1.73
  
• d2j5kb2 appears in SCOPe 2.07