Lineage for d2j5kb1 (2j5k B:22-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844865Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries)
  8. 2844871Domain d2j5kb1: 2j5k B:22-162 [138039]
    Other proteins in same PDB: d2j5ka2, d2j5kb2, d2j5kc2, d2j5kd2
    automated match to d1o6za1
    complexed with cl

Details for d2j5kb1

PDB Entry: 2j5k (more details), 2 Å

PDB Description: 2.0 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui (radiation damage series)
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2j5kb1:

Sequence, based on SEQRES records: (download)

>d2j5kb1 c.2.1.5 (B:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Sequence, based on observed residues (ATOM records): (download)

>d2j5kb1 c.2.1.5 (B:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
nrhlyeagdrsreqvig

SCOPe Domain Coordinates for d2j5kb1:

Click to download the PDB-style file with coordinates for d2j5kb1.
(The format of our PDB-style files is described here.)

Timeline for d2j5kb1: