Lineage for d2j5ha1 (2j5h A:1-39)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 748120Family g.3.11.7: Cripto EGF-like domain-like [144100] (1 protein)
  6. 748121Protein Cripto growth factor [144101] (1 species)
    Teratocarcinoma-derived growth factor
  7. 748122Species Mouse (Mus musculus) [TaxId:10090] [144102] (1 PDB entry)
  8. 748123Domain d2j5ha1: 2j5h A:1-39 [138036]
    complexed with ace, nh2

Details for d2j5ha1

PDB Entry: 2j5h (more details)

PDB Description: nmr analysis of mouse cripto cfc domain
PDB Compounds: (A:) teratocarcinoma-derived growth factor

SCOP Domain Sequences for d2j5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5ha1 g.3.11.7 (A:1-39) Cripto growth factor {Mouse (Mus musculus) [TaxId: 10090]}
kehcgsilhgtwlpkkcslcrcwhgqlhclpqtflpgcd

SCOP Domain Coordinates for d2j5ha1:

Click to download the PDB-style file with coordinates for d2j5ha1.
(The format of our PDB-style files is described here.)

Timeline for d2j5ha1: