Lineage for d2j57c1 (2j57 C:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660501Protein Amicyanin [49505] (2 species)
  7. 660502Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries)
  8. 660526Domain d2j57c1: 2j57 C:1-105 [138023]
    Other proteins in same PDB: d2j57g1, d2j57h1, d2j57i1, d2j57j1
    automatically matched to d1aac__
    complexed with cu, tqq

Details for d2j57c1

PDB Entry: 2j57 (more details), 2.25 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-quinol in complex with amicyanin.
PDB Compounds: (C:) amicyanin

SCOP Domain Sequences for d2j57c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j57c1 b.6.1.1 (C:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2j57c1:

Click to download the PDB-style file with coordinates for d2j57c1.
(The format of our PDB-style files is described here.)

Timeline for d2j57c1: