SCOPe 2.01: Domain d2j56j1: 2j56 J:32-386

Lineage for d2j56j1 (2j56 J:32-386)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
   this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries)

8. Domain d2j56j1: 2j56 J:32-386 [138020]
   Other proteins in same PDB: d2j56a_, d2j56b_, d2j56l_, d2j56m_
   automatically matched to d2bbkh_
   complexed with cu, gol, na

Details for d2j56j1

PDB Entry: 2j56, 2.1 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.

PDB Compounds: (J:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2j56j1:

Sequence; same for both SEQRES and ATOM records:

>d2j56j1 b.69.2.1 (J:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

Timeline for d2j56j1:

• d2j56j1 first appeared in SCOP 1.73
  
• d2j56j1 appears in SCOP 1.75
  
• d2j56j1 appears in SCOPe 2.02
  
• d2j56j1 appears in the current release, SCOPe 2.08, called d2j56j_