Lineage for d2j56b_ (2j56 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114378Protein Amicyanin [49505] (2 species)
  7. 1114379Species Paracoccus denitrificans [TaxId:266] [49506] (33 PDB entries)
    Uniprot P22364
  8. 1114418Domain d2j56b_: 2j56 B: [138018]
    Other proteins in same PDB: d2j56h1, d2j56j1, d2j56l_, d2j56m_
    automated match to d1aac__
    complexed with cu, gol, na

Details for d2j56b_

PDB Entry: 2j56 (more details), 2.1 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d2j56b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j56b_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d2j56b_:

Click to download the PDB-style file with coordinates for d2j56b_.
(The format of our PDB-style files is described here.)

Timeline for d2j56b_: